Kallikrein 10 anticorps (N-Term)

N° du produit ABIN634235

L’anticorps Lapin Polyclonal anti-Kallikrein 10 a été validé pour WB. Il convient pour détecter Kallikrein 10 dans des échantillons de Humain.

Aperçu rapide pour Kallikrein 10 anticorps (N-Term) (ABIN634235)

Antigène: Kallikrein 10 (KLK10)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Kallikrein 10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Kallikrein 10 anticorps

Épitope: N-Term

Specificité: KLK10 antibody was raised against the N terminal of KLK10

Purification: Affinity purified

Immunogène: KLK10 antibody was raised using the N terminal of KLK10 corresponding to a region with amino acids LLPQNDTRLDPEAYGSPCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLTA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KLK10 Blocking Peptide, (ABIN5614388), is also available for use as a blocking control in assays to test for specificity of this KLK10 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Kallikrein 10

Antigène: Kallikrein 10 (KLK10)

Autre désignation: KLK10

Sujet: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: Système du Complément