TdT anticorps (N-Term)

N° du produit ABIN634239

Détail du produit anti-TdT anticorps

Antigène: TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TdT est non-conjugé

Application: Western Blotting (WB)

Specificité: DNTT antibody was raised against the N terminal of DNTT

Purification: Affinity purified

Immunogène: DNTT antibody was raised using the N terminal of DNTT corresponding to a region with amino acids FQDLVVFILEKKMGTTRRAFLMELARRKGFRVENELSDSVTHIVAENNSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DNTT Blocking Peptide, catalog no. 33R-3028, is also available for use as a blocking control in assays to test for specificity of this DNTT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNTT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TdT

Antigène: TdT (DNTT) (Deoxynucleotidyltransferase, terminal (DNTT))

Autre désignation: DNTT (DNTT Produits)

Synonymes: anticorps TdT, anticorps TDT, anticorps BB160593, anticorps Tdt, anticorps dntt-A, anticorps dntt, anticorps DNA nucleotidylexotransferase, anticorps deoxynucleotidyltransferase, terminal, anticorps DNA nucleotidylexotransferase L homeolog, anticorps terminal deoxynucleotidyl transferase, anticorps DNTT, anticorps dntt, anticorps Dntt, anticorps dntt.L, anticorps tdt

Sujet: DNTT is a template-independent DNA polymerase that catalyzes the addition of deoxynucleotides to the 3'-hydroxyl terminus of oligonucleotide primers. In vivo, DNTT is expressed in a restricted population of normal and malignant pre-B and pre-T lymphocytes during early differentiation, where it generates antigen receptor diversity by synthesizing non-germ line elements (N-regions) at the junctions of rearranged Ig heavy chain and T cell receptor geneegments.

Poids moléculaire: 58 kDa (MW of target protein)

Pathways: Réparation de l'ADN