PP5 anticorps (N-Term)

N° du produit ABIN634245

Cet anticorps anti-PP5 est un anticorps Lapin Polyclonal détectant PP5 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour PP5 anticorps (N-Term) (ABIN634245)

Antigène: PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PP5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PP5 anticorps

Épitope: N-Term

Specificité: PPP5 C antibody was raised against the N terminal of PPP5

Purification: Affinity purified

Immunogène: PPP5 C antibody was raised using the N terminal of PPP5 corresponding to a region with amino acids MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP5C Blocking Peptide, (ABIN5615528), is also available for use as a blocking control in assays to test for specificity of this PPP5C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PP5

Antigène: PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))

Autre désignation: PPP5C

Sujet: PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

Poids moléculaire: 57 kDa (MW of target protein)