ALOX15B anticorps (Middle Region)
-
- Antigène Voir toutes ALOX15B Anticorps
- ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Rat, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ALOX15B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ALOX15 B antibody was raised against the middle region of ALOX15
- Purification
- Affinity purified
- Immunogène
- ALOX15 B antibody was raised using the middle region of ALOX15 corresponding to a region with amino acids CHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQTNVI
- Top Product
- Discover our top product ALOX15B Anticorps primaire
-
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 253-490) antibody
ALOX15B Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 349-633) antibodyALOX15B Reactivité: Rat WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 1-200) antibodyALOX15B Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 181-280) antibodyALOX15B Reactivité: Humain WB, ELISA, IF Hôte: Souris Monoclonal 4A7 unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 1-200) antibodyALOX15B Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 13-110) antibodyALOX15B Reactivité: Rat ELISA, IF (cc), IF (p), IHC (p), IHC (fro) Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 597-627), (C-Term) antibodyALOX15B Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB17162 unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) antibodyALOX15B Reactivité: Humain, Souris WB, IF Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 1-676) antibodyALOX15B Reactivité: Humain ELISA, IF Hôte: Lapin Polyclonal unconjugated
anti-Arachidonate 15-Lipoxygenase B (ALOX15B) (AA 1-200) antibodyALOX15B Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ALOX15B Blocking Peptide, catalog no. 33R-1715, is also available for use as a blocking control in assays to test for specificity of this ALOX15B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALOX10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ALOX15B (Arachidonate 15-Lipoxygenase B (ALOX15B))
- Autre désignation
- ALOX15B (ALOX15B Produits)
- Synonymes
- anticorps 15-LOX-2, anticorps ALOX15B, anticorps arachidonate 15-lipoxygenase, type B, anticorps arachidonate 15-lipoxygenase B, anticorps ALOX15B, anticorps Alox15b, anticorps LOC100525835
- Sujet
- ALOX15B is a member of the lipoxygenase family of structurally related nonheme iron dioxygenases involved in the production of fatty acid hydroperoxides. The protein converts arachidonic acid exclusively to 15S-hydroperoxyeicosatetraenoic acid, while metabolizing linoleic acid less effectively.
- Poids moléculaire
- 72 kDa (MW of target protein)
-
