IL1A anticorps (N-Term)

N° du produit ABIN634266

Détail du produit anti-IL1A anticorps

Antigène: IL1A (Interleukin 1 alpha (IL1A))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL1A est non-conjugé

Application: Western Blotting (WB)

Specificité: IL1 alpha antibody was raised against the N terminal of IL1 A

Purification: Affinity purified

Immunogène: IL1 alpha antibody was raised using the N terminal of IL1 A corresponding to a region with amino acids VSYGPLHEGCMDQSVSLSISETSKTSKLTFKESMVVVATNGKVLKKRRLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL1 alpha Blocking Peptide, catalog no. 33R-9834, is also available for use as a blocking control in assays to test for specificity of this IL1 alpha antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL1A

Antigène: IL1A (Interleukin 1 alpha (IL1A))

Autre désignation: IL1 alpha (IL1A Produits)

Synonymes: anticorps IL-1A, anticorps IL1, anticorps IL1-ALPHA, anticorps IL1F1, anticorps IL-6, anticorps Il-1a, anticorps IL-1 alpha, anticorps IL-1alpha, anticorps L1A, anticorps interleukin 1 alpha, anticorps interleukin 6, anticorps IL1A, anticorps IL6, anticorps Il1a

Sujet: The IL1A protein is a member of the interleukin 1 cytokine family. This cytokine is a pleiotropic cytokine involved in various immune responses, inflammatory processes, and hematopoiesis. This cytokine is produced by monocytes and macrophages as a proprotein, which is proteolytically processed and released in response to cell injury, and thus induces apoptosis.

Poids moléculaire: 18 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Autophagy, Cancer Immune Checkpoints