ECT2 anticorps (Middle Region)

N° du produit ABIN634287

Cet anticorps anti-ECT2 Polyclonal Lapin (ABIN634287) détecte spécifiquement ECT2 dans WB. L’anticorps est réactif avec des échantillons de Humain et Souris.

Aperçu rapide pour ECT2 anticorps (Middle Region) (ABIN634287)

Antigène: ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ECT2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ECT2 anticorps

Épitope: Middle Region

Specificité: ECT2 antibody was raised against the middle region of ECT2

Purification: Affinity purified

Immunogène: ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ECT2 Blocking Peptide, (ABIN939857), is also available for use as a blocking control in assays to test for specificity of this ECT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ECT2

Antigène: ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))

Autre désignation: ECT2

Sujet: ECT2 is a transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of ECT2 is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis.

Poids moléculaire: 100 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway, Cell-Cell Junction Organization