ARF6 anticorps (Middle Region)

N° du produit ABIN634294

Cet anticorps Lapin Polyclonal détecte spécifiquement ARF6 dans WB. Il présente une réactivité envers Humain, Rat, Souris et Drosophila melanogaster.

Aperçu rapide pour ARF6 anticorps (Middle Region) (ABIN634294)

Antigène: ARF6 (ADP-Ribosylation Factor 6 (ARF6))

Reactivité: Humain, Rat, Souris, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARF6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ARF6 anticorps

Épitope: Middle Region

Specificité: ARF6 antibody was raised against the middle region of ARF6

Purification: Affinity purified

Immunogène: ARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARF6 Blocking Peptide, (ABIN5612137), is also available for use as a blocking control in assays to test for specificity of this ARF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARF6

Antigène: ARF6 (ADP-Ribosylation Factor 6 (ARF6))

Autre désignation: ARF6

Sujet: ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Steroid Hormone Mediated Signaling Pathway, Regulation of Actin Filament Polymerization, SARS-CoV-2 Protein Interactome