ARF6 anticorps (Middle Region)

N° du produit ABIN634294

Détail du produit anti-ARF6 anticorps

Antigène: ARF6 (ADP-Ribosylation Factor 6 (ARF6))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Drosophila melanogaster

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARF6 est non-conjugé

Application: Western Blotting (WB)

Specificité: ARF6 antibody was raised against the middle region of ARF6

Purification: Affinity purified

Immunogène: ARF6 antibody was raised using the middle region of ARF6 corresponding to a region with amino acids REMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARF6 Blocking Peptide, catalog no. 33R-7882, is also available for use as a blocking control in assays to test for specificity of this ARF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARF6

Antigène: ARF6 (ADP-Ribosylation Factor 6 (ARF6))

Autre désignation: ARF6 (ARF6 Produits)

Synonymes: anticorps AI788669, anticorps AW496366, anticorps MGC80156, anticorps arf6, anticorps wu:fj46d09, anticorps zgc:77665, anticorps wu:fa98a01, anticorps zgc:172028, anticorps ADP ribosylation factor 6, anticorps ADP-ribosylation factor 6, anticorps ADP ribosylation factor 6 L homeolog, anticorps Arf6 protein, anticorps ADP-ribosylation factor 6a, anticorps ADP-ribosylation factor 6b, anticorps ADP ribosylation factor like GTPase 6, anticorps ARF6, anticorps Arf6, anticorps arf6.2.L, anticorps arf6, anticorps arf6a, anticorps arf6b, anticorps ARL6

Sujet: ARF6 is a member of the human ARF family, which is part of the RAS superfamily. They are small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking and as activators of phospholipase D. ARF6 is localized to the plasma membrane, and regulates vesicular trafficking, remodelling of membrane lipids, and signaling pathways that lead to actin remodeling.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Steroid Hormone Mediated Signaling Pathway, Regulation of Actin Filament Polymerization, SARS-CoV-2 Protein Interactome