GNAQ anticorps

N° du produit ABIN634295

Détail du produit anti-GNAQ anticorps

Antigène: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNAQ est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GNAQ antibody was raised using a synthetic peptide corresponding to a region with amino acids DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GNAQ Blocking Peptide, catalog no. 33R-2030, is also available for use as a blocking control in assays to test for specificity of this GNAQ antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAQ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNAQ

Antigène: GNAQ (Guanine Nucleotide Binding Protein (G Protein), Q Polypeptide (GNAQ))

Autre désignation: GNAQ (GNAQ Produits)

Synonymes: anticorps si:ch73-270f14.2, anticorps CMC1, anticorps G-ALPHA-q, anticorps GAQ, anticorps SWS, anticorps Galphaq, anticorps Gnaq, anticorps g-alpha-q, anticorps gaq, anticorps gnaqb, anticorps 1110005L02Rik, anticorps 6230401I02Rik, anticorps AA408290, anticorps AW060788, anticorps Dsk1, anticorps Dsk10, anticorps Gq, anticorps GqI, anticorps guanine nucleotide binding protein (G protein), q polypeptide, anticorps G protein subunit alpha q, anticorps guanine nucleotide binding protein (G protein), q polypeptide S homeolog, anticorps guanine nucleotide binding protein, alpha q polypeptide, anticorps gnaq, anticorps GNAQ, anticorps Gnaq, anticorps gnaq.S

Sujet: Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction