ERAS anticorps (Middle Region)
-
- Antigène Voir toutes ERAS Anticorps
- ERAS (ES cell expressed Ras (ERAS))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ERAS est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ERAS antibody was raised against the middle region of ERAS
- Purification
- Affinity purified
- Immunogène
- ERAS antibody was raised using the middle region of ERAS corresponding to a region with amino acids AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF
- Top Product
- Discover our top product ERAS Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ERAS Blocking Peptide, catalog no. 33R-1453, is also available for use as a blocking control in assays to test for specificity of this ERAS antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ERAS antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ERAS (ES cell expressed Ras (ERAS))
- Autre désignation
- ERAS (ERAS Produits)
- Synonymes
- anticorps HRAS2, anticorps HRASP, anticorps HRasp, anticorps Ha-Ras2, anticorps ecat5, anticorps ES cell expressed Ras, anticorps ES cell-expressed Ras, anticorps ERAS, anticorps Eras
- Sujet
- Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. ERAS plays an important role in the tumor-like growth properties of embryonic stem cells.
- Poids moléculaire
- 25 kDa (MW of target protein)
-