ADA anticorps (Middle Region)
-
- Antigène Voir toutes ADA Anticorps
- ADA (Adenosine Deaminase (ADA))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ADA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ADA antibody was raised against the middle region of ADA
- Purification
- Affinity purified
- Immunogène
- ADA antibody was raised using the middle region of ADA corresponding to a region with amino acids ANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPE
- Top Product
- Discover our top product ADA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ADA Blocking Peptide, catalog no. 33R-1412, is also available for use as a blocking control in assays to test for specificity of this ADA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ADA (Adenosine Deaminase (ADA))
- Autre désignation
- ADA (ADA Produits)
- Synonymes
- anticorps ADA-like, anticorps xada, anticorps ADA, anticorps CG11994, anticorps Dmel\\CG11994, anticorps DrosADA, anticorps dADA, anticorps zgc:92028, anticorps adenosine deaminase, anticorps adenosine deaminase S homeolog, anticorps Adenosine deaminase, anticorps ADA, anticorps Ada, anticorps ada.S, anticorps ada
- Sujet
- ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.
- Poids moléculaire
- 41 kDa (MW of target protein)
- Pathways
- Regulation of G-Protein Coupled Receptor Protein Signaling, Ribonucleoside Biosynthetic Process
-