RHOC anticorps (N-Term)

N° du produit ABIN634331

L’anticorps Lapin Polyclonal anti-RHOC a été validé pour WB. Il convient pour détecter RHOC dans des échantillons de Humain, Souris, Rat, Chien, Drosophila melanogaster et C. elegans.

Aperçu rapide pour RHOC anticorps (N-Term) (ABIN634331)

Antigène: RHOC (Ras Homolog Gene Family, Member C (RHOC))

Reactivité: Humain, Souris, Rat, Chien, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOC est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RHOC anticorps

Épitope: N-Term

Specificité: RHOC antibody was raised against the N terminal of RHOC

Purification: Affinity purified

Immunogène: RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHOC Blocking Peptide, (ABIN5615860), is also available for use as a blocking control in assays to test for specificity of this RHOC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHOC

Antigène: RHOC (Ras Homolog Gene Family, Member C (RHOC))

Autre désignation: RHOC

Sujet: RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Signalisation WNT, Cell-Cell Junction Organization