RHOC anticorps (N-Term)

N° du produit ABIN634331

Détail du produit anti-RHOC anticorps

Antigène: RHOC (Ras Homolog Gene Family, Member C (RHOC))

Épitope: N-Term

Reactivité: Humain, Souris, Rat, Chien, Drosophila melanogaster, C. elegans

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHOC est non-conjugé

Application: Western Blotting (WB)

Specificité: RHOC antibody was raised against the N terminal of RHOC

Purification: Affinity purified

Immunogène: RHOC antibody was raised using the N terminal of RHOC corresponding to a region with amino acids VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHOC Blocking Peptide, catalog no. 33R-9740, is also available for use as a blocking control in assays to test for specificity of this RHOC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHOC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHOC

Antigène: RHOC (Ras Homolog Gene Family, Member C (RHOC))

Autre désignation: RHOC (RHOC Produits)

Synonymes: anticorps ARHC, anticorps LOC100221682, anticorps ARH9, anticorps H9, anticorps RHOH9, anticorps AI324259, anticorps Arh9, anticorps Arhc, anticorps CRHOC, anticorps ras homolog family member C L homeolog, anticorps ras homolog family member C, anticorps rhoc.L, anticorps RHOC, anticorps rhoc, anticorps Rhoc

Sujet: RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Signalisation WNT, Cell-Cell Junction Organization