CAMKII gamma anticorps (N-Term)

N° du produit ABIN634349

Détail du produit anti-CAMKII gamma anticorps

Antigène: CAMKII gamma (CAMK2G) (Calcium/calmodulin-Dependent Protein Kinase II gamma (CAMK2G))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CAMKII gamma est non-conjugé

Application: Western Blotting (WB)

Specificité: CAMKII antibody was raised against the N terminal of CAMKK2

Purification: Affinity purified

Immunogène: CAMKII antibody was raised using the N terminal of CAMKK2 corresponding to a region with amino acids GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CAMKII Blocking Peptide, catalog no. 33R-3291, is also available for use as a blocking control in assays to test for specificity of this CAMKII antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMKK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CAMKII gamma

Antigène: CAMKII gamma (CAMK2G) (Calcium/calmodulin-Dependent Protein Kinase II gamma (CAMK2G))

Autre désignation: CAMKII (CAMK2G Produits)

Synonymes: anticorps CAMK, anticorps CAMK-II, anticorps CAMKG, anticorps 5930429P18Rik, anticorps Camkg, anticorps calcium/calmodulin dependent protein kinase II gamma, anticorps calcium/calmodulin-dependent protein kinase II gamma, anticorps CAMK2G, anticorps Camk2g

Sujet: CAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Signalisation WNT, Interferon-gamma Pathway, Hormone Transport, Myometrial Relaxation and Contraction, Regulation of long-term Neuronal Synaptic Plasticity