DDAH1 anticorps (Middle Region)
-
- Antigène Voir toutes DDAH1 Anticorps
- DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DDAH1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DDAH1 antibody was raised against the middle region of DDAH1
- Purification
- Affinity purified
- Immunogène
- DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT
- Top Product
- Discover our top product DDAH1 Anticorps primaire
-
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 20-215) antibody
DDAH1 Reactivité: Humain WB, IHC, IP, ICC Hôte: Lapin Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (C-Term) antibodyVerified DDAH1 Reactivité: Humain WB, ELISA, IF, FACS Hôte: Chèvre Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 221-250), (C-Term) antibodyDDAH1 Reactivité: Humain, Souris WB, IF, FACS, IHC (p) Hôte: Lapin Polyclonal RB20529 unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) antibodyDDAH1 Reactivité: Humain, Souris, Rat WB, IHC, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (C-Term) antibodyDDAH1 Reactivité: Humain WB, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 181-285) antibodyDDAH1 Reactivité: Humain WB, ELISA Hôte: Souris Monoclonal 3F7 unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 1-285) antibodyDDAH1 Reactivité: Humain WB, IF, IP Hôte: Lapin Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) antibodyDDAH1 Reactivité: Humain WB Hôte: Lapin Monoclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 108-157) antibodyDDAH1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cobaye, Cheval, Lapin, Poisson zèbre (Danio rerio), Chien, Singe, Porc, Xenopus laevis, Roussette (Chauve-souris), Poulet WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Dimethylarginine Dimethylaminohydrolase 1 (DDAH1) (AA 108-157) antibodyDDAH1 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Cobaye, Cheval, Lapin, Singe, Porc, Xenopus laevis, Roussette (Chauve-souris), Poulet, Drosophila melanogaster WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DDAH1 Blocking Peptide, catalog no. 33R-1330, is also available for use as a blocking control in assays to test for specificity of this DDAH1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DDAH1 (Dimethylarginine Dimethylaminohydrolase 1 (DDAH1))
- Autre désignation
- DDAH1 (DDAH1 Produits)
- Synonymes
- anticorps DDAH, anticorps 2410006N07Rik, anticorps 2510015N06Rik, anticorps AI987801, anticorps AW050362, anticorps DDAH1, anticorps wu:fc30c11, anticorps zgc:85829, anticorps dimethylarginine dimethylaminohydrolase 1, anticorps dimethylarginine dimethylaminohydrolase 1 L homeolog, anticorps DDAH1, anticorps Ddah1, anticorps ddah1.L, anticorps ddah1
- Sujet
- DDAH1 belongs to the dimethylarginine dimethylaminohydrolase (DDAH) family. This enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which in turn inhibit nitric oxide synthase activity.
- Poids moléculaire
- 31 kDa (MW of target protein)
-
