DDAH2 anticorps (N-Term)

N° du produit ABIN634365

Cet anticorps anti-DDAH2 est un anticorps Lapin Polyclonal détectant DDAH2 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour DDAH2 anticorps (N-Term) (ABIN634365)

Antigène: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDAH2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DDAH2 anticorps

Épitope: N-Term

Specificité: DDAH2 antibody was raised against the N terminal of DDAH2

Purification: Affinity purified

Immunogène: DDAH2 antibody was raised using the N terminal of DDAH2 corresponding to a region with amino acids MYTLHTKRVKAAARQMWTSNLSKVRQSLKNVYHKCKIRHQDSTGYPTVTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDAH2 Blocking Peptide, (ABIN5613148), is also available for use as a blocking control in assays to test for specificity of this DDAH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDAH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDAH2

Antigène: DDAH2 (Dimethylarginine Dimethylaminohydrolase 2 (DDAH2))

Autre désignation: DDAH2

Sujet: DDAH2 hydrolyzes N(G),N(G)-dimethyl-L-arginine (ADMA) and N(G)-monomethyl-L-arginine (MMA) which act as inhibitors of NOS. DDAH2 has therefore a role in nitric oxide generation.

Poids moléculaire: 31 kDa (MW of target protein)