RAB18 anticorps (C-Term)

N° du produit ABIN634369

Cet anticorps Lapin Polyclonal détecte spécifiquement RAB18 dans WB. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour RAB18 anticorps (C-Term) (ABIN634369)

Antigène: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB18 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAB18 anticorps

Épitope: C-Term

Specificité: RAB18 antibody was raised against the C terminal of RAB18

Purification: Affinity purified

Immunogène: RAB18 antibody was raised using the C terminal of RAB18 corresponding to a region with amino acids LFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKLSHREEGQG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB18 Blocking Peptide, (ABIN940325), is also available for use as a blocking control in assays to test for specificity of this RAB18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB18

Antigène: RAB18 (RAB18, Member RAS Oncogene Family (RAB18))

Autre désignation: RAB18

Sujet: RAB18 belongs to the small GTPase superfamily.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome