SH3BP2 anticorps (Middle Region)

N° du produit ABIN634378

Cet anticorps Lapin Polyclonal détecte spécifiquement SH3BP2 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour SH3BP2 anticorps (Middle Region) (ABIN634378)

Antigène: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH3BP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SH3BP2 anticorps

Épitope: Middle Region

Specificité: SH3 BP2 antibody was raised against the middle region of SH3 P2

Purification: Affinity purified

Immunogène: SH3 BP2 antibody was raised using the middle region of SH3 P2 corresponding to a region with amino acids RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH3BP2 Blocking Peptide, (ABIN5616123), is also available for use as a blocking control in assays to test for specificity of this SH3BP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH3BP2

Antigène: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Autre désignation: SH3BP2

Sujet: SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: TCR Signaling