SH3BP2 anticorps (Middle Region)

N° du produit ABIN634378

Détail du produit anti-SH3BP2 anticorps

Antigène: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SH3BP2 est non-conjugé

Application: Western Blotting (WB)

Specificité: SH3 BP2 antibody was raised against the middle region of SH3 P2

Purification: Affinity purified

Immunogène: SH3 BP2 antibody was raised using the middle region of SH3 P2 corresponding to a region with amino acids RQPSQADTGGDDSDEDYEKVPLPNSVFVNTTESCEVERLFKATSPRGEPQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SH3BP2 Blocking Peptide, catalog no. 33R-8125, is also available for use as a blocking control in assays to test for specificity of this SH3BP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SH0 P2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SH3BP2

Antigène: SH3BP2 (SH3-Domain Binding Protein 2 (SH3BP2))

Autre désignation: SH3BP2 (SH3BP2 Produits)

Synonymes: anticorps SH3BP2, anticorps 3BP-2, anticorps 3BP2, anticorps CRBM, anticorps CRPM, anticorps SH3 domain binding protein 2, anticorps SH3-domain binding protein 2, anticorps SH3BP2, anticorps Sh3bp2

Sujet: SH3BP2 has an N-terminal pleckstrin homology (PH) domain, an SH3-binding proline-rich region, and a C-terminal SH2 domain. The protein binds to the SH3 domains of several proteins including the ABL1 and SYK protein tyrosine kinases, and functions as a cytoplasmic adaptor protein to positively regulate transcriptional activity in T, natural killer (NK), and basophilic cells. Mutations in this gene result in cherubism.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: TCR Signaling