IFIT5 anticorps (Middle Region)

N° du produit ABIN634393

Cet anticorps Lapin Polyclonal détecte spécifiquement IFIT5 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour IFIT5 anticorps (Middle Region) (ABIN634393)

Antigène: IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IFIT5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IFIT5 anticorps

Épitope: Middle Region

Specificité: IFIT5 antibody was raised against the middle region of IFIT5

Purification: Affinity purified

Immunogène: IFIT5 antibody was raised using the middle region of IFIT5 corresponding to a region with amino acids ITVYRLDDSDREGSVKSFSLGPLRKAVTLNPDNSYIKVFLALKLQDVHAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IFIT5 Blocking Peptide, (ABIN939578), is also available for use as a blocking control in assays to test for specificity of this IFIT5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFIT5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IFIT5

Antigène: IFIT5 (Interferon-Induced Protein with Tetratricopeptide Repeats 5 (IFIT5))

Autre désignation: IFIT5

Sujet: IFIT5 belongs to the IFIT family. It contains 8 TPR repeats. The exact function of IFIT5 remains unknown.

Poids moléculaire: 56 kDa (MW of target protein)