RGS4 anticorps (C-Term)

N° du produit ABIN634407

Cet anticorps anti-RGS4 est un anticorps Lapin Polyclonal détectant RGS4 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour RGS4 anticorps (C-Term) (ABIN634407)

Antigène: RGS4 (Regulator of G-Protein Signaling 4 (RGS4))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RGS4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RGS4 anticorps

Épitope: C-Term

Specificité: RGS4 antibody was raised against the C terminal of RGS4

Purification: Affinity purified

Immunogène: RGS4 antibody was raised using the C terminal of RGS4 corresponding to a region with amino acids EAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RGS4 Blocking Peptide, (ABIN937662), is also available for use as a blocking control in assays to test for specificity of this RGS4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RGS4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RGS4

Antigène: RGS4 (Regulator of G-Protein Signaling 4 (RGS4))

Autre désignation: RGS4

Sujet: Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 4 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain. This protein negatively regulates signaling upstream or at the level of the heterotrimeric G protein and is localized in the cytoplasm.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling