SOCS7 anticorps (N-Term)

N° du produit ABIN634408

Détail du produit anti-SOCS7 anticorps

Antigène: SOCS7 (Suppressor of Cytokine Signaling 7 (SOCS7))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SOCS7 est non-conjugé

Application: Western Blotting (WB)

Specificité: SOCS7 antibody was raised against the N terminal of SOCS7

Purification: Affinity purified

Immunogène: SOCS7 antibody was raised using the N terminal of SOCS7 corresponding to a region with amino acids LDPKALPPGLALERTWGPAAGLEAQLAALGLGQPAGPGVKTVGGGCCPCP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SOCS7 Blocking Peptide, catalog no. 33R-4853, is also available for use as a blocking control in assays to test for specificity of this SOCS7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SOCS7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SOCS7

Antigène: SOCS7 (Suppressor of Cytokine Signaling 7 (SOCS7))

Autre désignation: SOCS7 (SOCS7 Produits)

Synonymes: anticorps NAP4, anticorps NCKAP4, anticorps SOCS4, anticorps SOCS6, anticorps 2310063P06Rik, anticorps C85125, anticorps Nap4, anticorps GB13951, anticorps zgc:175115, anticorps SOCS7, anticorps socs7, anticorps suppressor of cytokine signaling 7, anticorps suppressor of cytokine signaling, anticorps SOCS7, anticorps Socs7, anticorps LOC413772, anticorps socs7

Sujet: SOCS7 regulates signaling cascades probably through protein ubiquitination and/or sequestration. SOCS7 functions in insulin signaling and glucose homeostasis through IRS1 ubiquitination and subsequent proteasomal degradation. SOCS7 inhibits also prolactin, growth hormone and leptin signaling by preventing STAT3 and STAT5 activation, sequestering them in the cytoplasm and reducing their binding to DNA. SOCS7 may be a substrate recognition component of a SCF-like E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Poids moléculaire: 64 kDa (MW of target protein)