TP53TG5 anticorps (Middle Region)
-
- Antigène Voir toutes TP53TG5 Anticorps
- TP53TG5 (TP53 Target 5 (TP53TG5))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TP53TG5 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- C20 ORF10 antibody was raised against the middle region of C20 rf10
- Purification
- Affinity purified
- Immunogène
- C20 ORF10 antibody was raised using the middle region of C20 rf10 corresponding to a region with amino acids TSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYRN
- Top Product
- Discover our top product TP53TG5 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C20ORF10 Blocking Peptide, catalog no. 33R-9289, is also available for use as a blocking control in assays to test for specificity of this C20ORF10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TP53TG5 (TP53 Target 5 (TP53TG5))
- Autre désignation
- C20ORF10 (TP53TG5 Produits)
- Synonymes
- anticorps TP53TG5, anticorps C20orf10, anticorps CLG01, anticorps TP53 target 5, anticorps TP53TG5
- Sujet
- C20orf10 may play a significant role in p53/TP53-mediating signaling pathway.
- Poids moléculaire
- 32 kDa (MW of target protein)
-