ADA anticorps (N-Term)

N° du produit ABIN634435

Cet anticorps Lapin Polyclonal détecte spécifiquement ADA dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour ADA anticorps (N-Term) (ABIN634435)

Antigène: ADA (Adenosine Deaminase (ADA))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ADA anticorps

Épitope: N-Term

Specificité: ADA antibody was raised against the N terminal of ADA

Purification: Affinity purified

Immunogène: ADA antibody was raised using the N terminal of ADA corresponding to a region with amino acids AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADA Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this ADA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADA

Antigène: ADA (Adenosine Deaminase (ADA))

Autre désignation: ADA

Sujet: ADA is an enzyme that catalyzes the hydrolysis of adenosine to inosine. Various mutations have been described for this gene and have been linked to human diseases. Deficiency in this enzyme causes a form of severe combined immunodeficiency disease (SCID), in which there is dysfunction of both B and T lymphocytes with impaired cellular immunity and decreased production of immunoglobulins, whereas elevated levels of this enzyme have been associated with congenital hemolytic anemia.

Poids moléculaire: 41 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Ribonucleoside Biosynthetic Process