RABL4 anticorps (C-Term)

N° du produit ABIN634436

L’anticorps Lapin Polyclonal anti-RABL4 a été validé pour WB. Il convient pour détecter RABL4 dans des échantillons de Humain.

Aperçu rapide pour RABL4 anticorps (C-Term) (ABIN634436)

Antigène: RABL4 (IFT27) (Intraflagellar Transport 27 Homolog (IFT27))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RABL4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RABL4 anticorps

Épitope: C-Term

Specificité: RABL4 antibody was raised against the C terminal of RABL4

Purification: Affinity purified

Immunogène: RABL4 antibody was raised using the C terminal of RABL4 corresponding to a region with amino acids RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RABL4 Blocking Peptide, (ABIN5615724), is also available for use as a blocking control in assays to test for specificity of this RABL4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RABL4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RABL4

Antigène: RABL4 (IFT27) (Intraflagellar Transport 27 Homolog (IFT27))

Autre désignation: RABL4

Sujet: RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Signalisation Hedgehog