RAB38 anticorps (N-Term)

N° du produit ABIN634438

Détail du produit anti-RAB38 anticorps

Antigène: RAB38 (RAB38, Member RAS Oncogene Family (RAB38))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB38 est non-conjugé

Application: Western Blotting (WB)

Specificité: RAB38 antibody was raised against the N terminal of RAB38

Purification: Affinity purified

Immunogène: RAB38 antibody was raised using the N terminal of RAB38 corresponding to a region with amino acids MQAPHKEHLYKLLVIGDLGVGKTSIIKRYVHQNFSSHYRATIGVDFALKV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB38 Blocking Peptide, catalog no. 33R-6318, is also available for use as a blocking control in assays to test for specificity of this RAB38 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB38 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB38

Antigène: RAB38 (RAB38, Member RAS Oncogene Family (RAB38))

Autre désignation: RAB38 (RAB38 Produits)

Synonymes: anticorps RAB38, anticorps rab38, anticorps 2310011F14Rik, anticorps AU043391, anticorps cht, anticorps NY-MEL-1, anticorps rrGTPbp, anticorps R, anticorps Ruby, anticorps RAB38, member RAS oncogene family, anticorps RAB38a, member RAS oncogene family, anticorps RAB38, member RAS oncogene family S homeolog, anticorps RAB38, anticorps rab38a, anticorps rab38.S, anticorps Rab38

Sujet: RAB38 may be involved in melanosomal transport and docking. Involved in the proper sorting of TYRP1.

Poids moléculaire: 24 kDa (MW of target protein)