RAB11B anticorps (C-Term)
-
- Antigène Voir toutes RAB11B Anticorps
- RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAB11B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RAB11 B antibody was raised against the C terminal of RAB11
- Purification
- Affinity purified
- Immunogène
- RAB11 B antibody was raised using the C terminal of RAB11 corresponding to a region with amino acids IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV
- Top Product
- Discover our top product RAB11B Anticorps primaire
-
anti-RAB11B, Member RAS Oncogene Family (RAB11B) (C-Term) antibody
RAB11B Reactivité: Humain, Souris, Rat, Chien, Chévre, Cobaye, Boeuf (Vache), Hamster, Porc, Singe, Cat, Poulet, Âne, Cheval, Lapin, Mouton, Avian WB, IF Hôte: Chèvre Polyclonal unconjugated
anti-RAB11B, Member RAS Oncogene Family (RAB11B) (C-Term) antibodyRAB11B Reactivité: Humain, Rat WB, ELISA, IF, IHC, ICC Hôte: Lapin Polyclonal unconjugated
anti-RAB11B, Member RAS Oncogene Family (RAB11B) (AA 164-193), (C-Term) antibodyRAB11B Reactivité: Humain, Rat WB, IHC (p) Hôte: Lapin Polyclonal RB30239 unconjugated
anti-RAB11B, Member RAS Oncogene Family (RAB11B) (AA 130-215) antibodyRAB11B Reactivité: Humain WB, IF Hôte: Lapin Polyclonal unconjugated
anti-RAB11B, Member RAS Oncogene Family (RAB11B) (AA 2-215) antibodyRAB11B Reactivité: Humain WB, ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-RAB11B, Member RAS Oncogene Family (RAB11B) (AA 1-218) antibodyRAB11B Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-RAB11B, Member RAS Oncogene Family (RAB11B) (C-Term) antibodyRAB11B Reactivité: Humain, Souris, Rat, Chien, Chévre, Cobaye, Boeuf (Vache), Poisson zèbre (Danio rerio), Hamster, Porc, Singe, Roussette (Chauve-souris) WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAB11B Blocking Peptide, catalog no. 33R-3953, is also available for use as a blocking control in assays to test for specificity of this RAB11B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))
- Autre désignation
- RAB11B (RAB11B Produits)
- Synonymes
- anticorps zgc:92772, anticorps H-YPT3, anticorps A730055L17Rik, anticorps rab11b, anticorps wu:fb07g11, anticorps zgc:55760, anticorps RAB11B, member RAS oncogene family, b, anticorps RAB11B, member RAS oncogene family, anticorps RAB11B, member RAS oncogene family, a, anticorps RAB11B, member RAS oncogene family, gene 1 S homeolog, anticorps rab11bb, anticorps RAB11B, anticorps Rab11b, anticorps rab11ba, anticorps rab11b.1.S
- Sujet
- RAB11B possesses GTPase activity.
- Poids moléculaire
- 24 kDa (MW of target protein)
- Pathways
- Hormone Transport, Carbohydrate Homeostasis
-
