RAB11B anticorps (C-Term)

N° du produit ABIN634441

Cet anticorps Lapin Polyclonal détecte spécifiquement RAB11B dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour RAB11B anticorps (C-Term) (ABIN634441)

Antigène: RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAB11B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAB11B anticorps

Épitope: C-Term

Specificité: RAB11 B antibody was raised against the C terminal of RAB11

Purification: Affinity purified

Immunogène: RAB11 B antibody was raised using the C terminal of RAB11 corresponding to a region with amino acids IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAB11B Blocking Peptide, (ABIN939339), is also available for use as a blocking control in assays to test for specificity of this RAB11B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAB11B

Antigène: RAB11B (RAB11B, Member RAS Oncogene Family (RAB11B))

Autre désignation: RAB11B

Sujet: RAB11B possesses GTPase activity.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Hormone Transport, Carbohydrate Homeostasis