WWP1 anticorps (N-Term)

N° du produit ABIN634475

L’anticorps Lapin Polyclonal anti-WWP1 a été validé pour WB. Il convient pour détecter WWP1 dans des échantillons de Humain.

Aperçu rapide pour WWP1 anticorps (N-Term) (ABIN634475)

Antigène: WWP1 (WW Domain Containing E3 Ubiquitin Protein Ligase 1 (WWP1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WWP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WWP1 anticorps

Épitope: N-Term

Specificité: WWP1 antibody was raised against the N terminal of WWP1

Purification: Affinity purified

Immunogène: WWP1 antibody was raised using the N terminal of WWP1 corresponding to a region with amino acids ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WWP1 Blocking Peptide, (ABIN936936), is also available for use as a blocking control in assays to test for specificity of this WWP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WWP1

Antigène: WWP1 (WW Domain Containing E3 Ubiquitin Protein Ligase 1 (WWP1))

Autre désignation: WWP1

Sujet: WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. WWP1 is a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. WWP1 belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes.WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing.

Poids moléculaire: 105 kDa (MW of target protein)