WWP1 anticorps (N-Term)

N° du produit ABIN634475

Détail du produit anti-WWP1 anticorps

Antigène: WWP1 (WW Domain Containing E3 Ubiquitin Protein Ligase 1 (WWP1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WWP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: WWP1 antibody was raised against the N terminal of WWP1

Purification: Affinity purified

Immunogène: WWP1 antibody was raised using the N terminal of WWP1 corresponding to a region with amino acids ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WWP1 Blocking Peptide, catalog no. 33R-1550, is also available for use as a blocking control in assays to test for specificity of this WWP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WWP1

Antigène: WWP1 (WW Domain Containing E3 Ubiquitin Protein Ligase 1 (WWP1))

Autre désignation: WWP1 (WWP1 Produits)

Synonymes: anticorps AIP5, anticorps Tiul1, anticorps hSDRP1, anticorps 8030445B08Rik, anticorps SDRP1, anticorps WWP1, anticorps aip5, anticorps tiul1, anticorps hsdrp1, anticorps WW domain containing E3 ubiquitin protein ligase 1, anticorps WWP1, anticorps Wwp1, anticorps wwp1

Sujet: WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing. WWP1 is a protein which contains 4 tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. WWP1 belongs to a family of NEDD4-like proteins, which are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes.WW domain-containing proteins are found in all eukaryotes and play an important role in the regulation of a wide variety of cellular functions such as protein degradation, transcription, and RNA splicing.

Poids moléculaire: 105 kDa (MW of target protein)