LBP anticorps (C-Term)

N° du produit ABIN634479

Cet anticorps anti-LBP est un anticorps Polyclonal produit chez le Lapin, détectant LBP dans WB. Convient pour Humain.

Aperçu rapide pour LBP anticorps (C-Term) (ABIN634479)

Antigène: LBP (Lipopolysaccharide Binding Protein (LBP))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LBP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LBP anticorps

Épitope: C-Term

Specificité: LBP antibody was raised against the C terminal of LBP

Purification: Affinity purified

Immunogène: LBP antibody was raised using the C terminal of LBP corresponding to a region with amino acids FLKPGKVKVELKESKVGLFNAELLEALLNYYILNTFYPKFNDKLAEGFPL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LBP Blocking Peptide, (ABIN938351), is also available for use as a blocking control in assays to test for specificity of this LBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LBP

Antigène: LBP (Lipopolysaccharide Binding Protein (LBP))

Autre désignation: LBP

Sujet: LBP is involved in the acute-phase immunologic response to gram-negative bacterial infections. Gram-negative bacteria contain a glycolipid, lipopolysaccharide (LPS), on their outer cell wall. Together with bactericidal permeability-increasing protein (BPI), the protein binds LPS and interacts with the CD14 receptor, probably playing a role in regulating LPS-dependent monocyte responses.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Toll-Like Receptors Cascades, Monocarboxylic Acid Catabolic Process