IL-15 anticorps (N-Term)

N° du produit ABIN634483

Cet anticorps Lapin Polyclonal détecte spécifiquement IL-15 dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour IL-15 anticorps (N-Term) (ABIN634483)

Antigène: IL-15 (IL15) (Interleukin 15 (IL15))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IL-15 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-IL-15 anticorps

Épitope: N-Term

Specificité: IL15 antibody was raised against the N terminal of IL15

Purification: Affinity purified

Immunogène: IL15 antibody was raised using the N terminal of IL15 corresponding to a region with amino acids RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IL15 Blocking Peptide, (ABIN5614168), is also available for use as a blocking control in assays to test for specificity of this IL15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IL-15

Antigène: IL-15 (IL15) (Interleukin 15 (IL15))

Autre désignation: IL15

Sujet: IL15 is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis.

Poids moléculaire: 13 kDa (MW of target protein)

Pathways: Signalistation JAK/STAT, Glycosaminoglycan Metabolic Process