IL-15 anticorps (N-Term)
-
- Antigène Voir toutes IL-15 (IL15) Anticorps
- IL-15 (IL15) (Interleukin 15 (IL15))
-
Épitope
- N-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IL-15 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- IL15 antibody was raised against the N terminal of IL15
- Purification
- Affinity purified
- Immunogène
- IL15 antibody was raised using the N terminal of IL15 corresponding to a region with amino acids RISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWV
- Top Product
- Discover our top product IL15 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IL15 Blocking Peptide, catalog no. 33R-7982, is also available for use as a blocking control in assays to test for specificity of this IL15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IL-15 (IL15) (Interleukin 15 (IL15))
- Autre désignation
- IL15 (IL15 Produits)
- Synonymes
- anticorps IL15, anticorps AI503618, anticorps IL-15, anticorps interleukin 15, anticorps IL15, anticorps Il15
- Sujet
- IL15 is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis.
- Poids moléculaire
- 13 kDa (MW of target protein)
- Pathways
- Signalistation JAK/STAT, Glycosaminoglycan Metabolic Process
-