BPIFA1 anticorps (Middle Region)

N° du produit ABIN634486

Cet anticorps Lapin Polyclonal détecte spécifiquement BPIFA1 dans WB. Il présente une réactivité envers Humain, Rat, Souris et Chien.

Aperçu rapide pour BPIFA1 anticorps (Middle Region) (ABIN634486)

Antigène: BPIFA1 (BPI Fold Containing Family A, Member 1 (BPIFA1))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BPIFA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BPIFA1 anticorps

Épitope: Middle Region

Specificité: PLUNC antibody was raised against the middle region of PLUNC

Purification: Affinity purified

Immunogène: PLUNC antibody was raised using the middle region of PLUNC corresponding to a region with amino acids GLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASL

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PLUNC Blocking Peptide, (ABIN938798), is also available for use as a blocking control in assays to test for specificity of this PLUNC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLUNC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BPIFA1

Antigène: BPIFA1 (BPI Fold Containing Family A, Member 1 (BPIFA1))

Autre désignation: PLUNC

Sujet: PLUNC is the human homolog of murine plunc and is specifically expressed in the upper airways and nasopharyngeal regions. The exact biological function of this protein is not known, however, it has been suggested to be involved in inflammatory responses to irritants in the upper airways. It may also serve as a potential molecular marker for detection of micrometastasis in non-small-cell lung cancer.

Poids moléculaire: 28 kDa (MW of target protein)