CHIA anticorps (N-Term)

N° du produit ABIN634493

L’anticorps Lapin Polyclonal anti-CHIA a été validé pour WB. Il convient pour détecter CHIA dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour CHIA anticorps (N-Term) (ABIN634493)

Antigène: CHIA (Chitinase, Acidic (CHIA))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHIA est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CHIA anticorps

Épitope: N-Term

Specificité: CHIA antibody was raised against the N terminal of CHIA

Purification: Affinity purified

Immunogène: CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHIA Blocking Peptide, (ABIN5612848), is also available for use as a blocking control in assays to test for specificity of this CHIA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHIA

Antigène: CHIA (Chitinase, Acidic (CHIA))

Autre désignation: CHIA

Sujet: CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.

Poids moléculaire: 40 kDa (MW of target protein)