CHIA anticorps (N-Term)

N° du produit ABIN634493

Détail du produit anti-CHIA anticorps

Antigène: CHIA (Chitinase, Acidic (CHIA))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHIA est non-conjugé

Application: Western Blotting (WB)

Specificité: CHIA antibody was raised against the N terminal of CHIA

Purification: Affinity purified

Immunogène: CHIA antibody was raised using the N terminal of CHIA corresponding to a region with amino acids MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHIA Blocking Peptide, catalog no. 33R-6610, is also available for use as a blocking control in assays to test for specificity of this CHIA antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHIA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHIA

Antigène: CHIA (Chitinase, Acidic (CHIA))

Autre désignation: CHIA (CHIA Produits)

Synonymes: anticorps chia-a, anticorps AMCASE, anticorps CHIT2, anticorps TSA1902, anticorps 2200003E03Rik, anticorps AMCase, anticorps YNL, anticorps CHIA, anticorps chioIIa, anticorps fa55g10, anticorps wu:fa55g10, anticorps zgc:63792, anticorps acidic mammalian chitinase, anticorps chitinase, acidic, anticorps chitinase, acidic S homeolog, anticorps chitinase-M31, acidic, anticorps chitinase, acidic 1, anticorps chitinase, acidic.4, anticorps LOC703284, anticorps CHIA, anticorps LOC100600050, anticorps chia.S, anticorps CHIA-M31, anticorps Chia1, anticorps Chia, anticorps chia.4

Sujet: CHIA belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. It contains 1 chitin-binding type-2 domain. The protein degrades chitin and chitotriose. And it may participate in the defense against nematodes and other pathogens.

Poids moléculaire: 40 kDa (MW of target protein)