CD40 anticorps (N-Term)

N° du produit ABIN634498

Cet anticorps Lapin Polyclonal détecte spécifiquement CD40 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour CD40 anticorps (N-Term) (ABIN634498)

Antigène: CD40

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CD40 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CD40 anticorps

Épitope: N-Term

Specificité: CD40 antibody was raised against the N terminal of CD40

Purification: Affinity purified

Immunogène: CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CD40 Blocking Peptide, (ABIN5612754), is also available for use as a blocking control in assays to test for specificity of this CD40 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CD40

Antigène: CD40

Autre désignation: CD40

Sujet: CD40 is the receptor for TNFSF5/CD40LG. Defects in CD40 are the cause of hyper-IgM immunodeficiency type 3 (HIGM3).

Poids moléculaire: 20 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Cellular Response to Molecule of Bacterial Origin, M Phase, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints