GADD45B anticorps (Middle Region)

N° du produit ABIN634503

Détail du produit anti-GADD45B anticorps

Antigène: GADD45B (Growth Arrest and DNA-Damage-Inducible, beta (GADD45B))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GADD45B est non-conjugé

Application: Western Blotting (WB)

Specificité: GADD45 B antibody was raised against the middle region of GADD45

Purification: Affinity purified

Immunogène: GADD45 B antibody was raised using the middle region of GADD45 corresponding to a region with amino acids FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GADD45B Blocking Peptide, catalog no. 33R-2851, is also available for use as a blocking control in assays to test for specificity of this GADD45B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GADD40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GADD45B

Antigène: GADD45B (Growth Arrest and DNA-Damage-Inducible, beta (GADD45B))

Autre désignation: GADD45B (GADD45B Produits)

Synonymes: anticorps GADD45BETA, anticorps MYD118, anticorps AI323528, anticorps Myd118, anticorps CS131, anticorps cb196, anticorps gadd45b, anticorps gadd45b2, anticorps sb:cb196, anticorps zgc:73104, anticorps gadd45beta, anticorps wu:fa92d10, anticorps wu:fa98h12, anticorps wu:fk65h03, anticorps zgc:111973, anticorps gadd45b1, anticorps gadd45bl, anticorps zgc:112453, anticorps growth arrest and DNA damage inducible beta, anticorps growth arrest and DNA-damage-inducible 45 beta, anticorps growth arrest and DNA-damage-inducible, beta, anticorps growth arrest and DNA-damage-inducible, beta a, anticorps growth arrest and DNA-damage-inducible, beta b, anticorps GADD45B, anticorps Gadd45b, anticorps gadd45ba, anticorps gadd45bb

Sujet: GADD45B is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The genes in this group respond to environmental stresses by mediating activation of the p38/JNK pathway. This activation is mediated via their proteins binding and activating MTK1/MEKK4 kinase, which is an upstream activator of both p38 and JNK MAPKs. The function of these genes or their protein products is involved in the regulation of growth and apoptosis. These genes are regulated by different mechanisms, but they are often coordinately expressed and can function cooperatively in inhibiting cell growth.

Poids moléculaire: 18 kDa (MW of target protein)

Pathways: Cycle Cellulaire