Beclin 1 anticorps (N-Term)

N° du produit ABIN634508

L’anticorps anti-Beclin 1 Polyclonal Lapin est utilisé pour la détection de Beclin 1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour Beclin 1 anticorps (N-Term) (ABIN634508)

Antigène: Beclin 1 (BECN1) (Beclin 1, Autophagy Related (BECN1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Beclin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Beclin 1 anticorps

Épitope: N-Term

Specificité: BECN1 antibody was raised against the N terminal of BECN1

Purification: Affinity purified

Immunogène: BECN1 antibody was raised using the N terminal of BECN1 corresponding to a region with amino acids MVRMVPVLLSLLLLLGPAVPQENQDGRYSLTYIYTGLSKHVEDVPAFQAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BECN1 Blocking Peptide, (ABIN5612311), is also available for use as a blocking control in assays to test for specificity of this BECN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BECN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Beclin 1

Antigène: Beclin 1 (BECN1) (Beclin 1, Autophagy Related (BECN1))

Autre désignation: BECN1

Sujet: BECN1 plays a central role in autophagy. BECN1 may play a role in antiviral host defense. BECN1 protects against infection by a neurovirulent strain of Sindbis virus.

Poids moléculaire: 50 kDa (MW of target protein)

Pathways: Autophagy