GPR177/WLS anticorps (Middle Region)

N° du produit ABIN634518

Cet anticorps anti-GPR177/WLS Polyclonal Lapin (ABIN634518) détecte spécifiquement GPR177/WLS dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour GPR177/WLS anticorps (Middle Region) (ABIN634518)

Antigène: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GPR177/WLS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GPR177/WLS anticorps

Épitope: Middle Region

Specificité: GPR177 antibody was raised against the middle region of GPR177

Purification: Affinity purified

Immunogène: GPR177 antibody was raised using the middle region of GPR177 corresponding to a region with amino acids DIRLVGIHQNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GPR177 Blocking Peptide, (ABIN937391), is also available for use as a blocking control in assays to test for specificity of this GPR177 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GPR177 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GPR177/WLS

Antigène: GPR177/WLS (WLS) (Wntless Homolog (WLS))

Autre désignation: GPR177

Sujet: GPR177 has signal transducer activity. It is positive regulation of I-kappaB kinase/NF-kappaB cascade.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Signalisation WNT