CCRL2 anticorps

N° du produit ABIN634522

Cet anticorps Lapin Polyclonal détecte spécifiquement CCRL2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour CCRL2 anticorps (ABIN634522)

Antigène: CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCRL2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CCRL2 anticorps

Purification: Affinity purified

Immunogène: CCRL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSAQLVPSLCSAVFVIGVLDNLLVVLILVKYKGLKRVENIYLLNLAVSNL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCRL2 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this CCRL2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCRL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCRL2

Antigène: CCRL2 (Chemokine (C-C Motif) Receptor-Like 2 (CCRL2))

Autre désignation: CCRL2

Sujet: CCRL2 is a chemokine receptor like protein, which is predicted to be a seven transmembrane protein and most closely related to CCR1. Chemokines and their receptors mediated signal transduction are critical for the recruitment of effector immune cells to the site of inflammation. CCRL2 gene is expressed at high levels in primary neutrophils and primary monocytes, and is further upregulated on neutrophil activation and during monocyte to macrophage differentiation. The function of this gene is unknown.

Poids moléculaire: 39 kDa (MW of target protein)