ADCY8 anticorps

N° du produit ABIN634530

Cet anticorps anti-ADCY8 est un anticorps Lapin Polyclonal détectant ADCY8 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour ADCY8 anticorps (ABIN634530)

Antigène: ADCY8 (Adenylate Cyclase 8 (Brain) (ADCY8))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADCY8 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ADCY8 anticorps

Purification: Affinity purified

Immunogène: ADCY8 antibody was raised using a synthetic peptide corresponding to a region with amino acids EIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLVQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ADCY8 Blocking Peptide, (ABIN937880), is also available for use as a blocking control in assays to test for specificity of this ADCY8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADCY8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADCY8

Antigène: ADCY8 (Adenylate Cyclase 8 (Brain) (ADCY8))

Autre désignation: ADCY8

Sujet: Adenylate cyclase is a membrane bound enzyme that catalyses the formation of cyclic AMP from ATP. The enzymatic activity is under the control of several hormones, and different polypeptides participate in the transduction of the signal from the receptor to the catalytic moiety. Stimulatory or inhibitory receptors (Rs and Ri) interact with G proteins (Gs and Gi) that exhibit GTPase activity and they modulate the activity of the catalytic subunit of the adenylyl cyclase.

Poids moléculaire: 140 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, cAMP Metabolic Process, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma