CCR2 anticorps

N° du produit ABIN634540

Cet anticorps Lapin Polyclonal détecte spécifiquement CCR2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour CCR2 anticorps (ABIN634540)

Antigène: CCR2 (Chemokine (C-C Motif) Receptor 2 (CCR2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCR2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CCR2 anticorps

Purification: Affinity purified

Immunogène: CCR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCR2 Blocking Peptide, (ABIN940440), is also available for use as a blocking control in assays to test for specificity of this CCR2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCR2

Antigène: CCR2 (Chemokine (C-C Motif) Receptor 2 (CCR2))

Autre désignation: CCR2

Sujet: This gene encodes two isoforms of a receptor for monocyte chemoattractant protein-1, a chemokine which specifically mediates monocyte chemotaxis. Monocyte chemoattractant protein-1 is involved in monocyte infiltration in inflammatory diseases such as rheumatoid arthritis as well as in the inflammatory response against tumors. The receptors encoded by this gene mediate agonist-dependent calcium mobilization and inhibition of adenylyl cyclase.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: cAMP Metabolic Process, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process