BAFF anticorps

N° du produit ABIN634541

L’anticorps anti-BAFF Polyclonal Lapin est utilisé pour la détection de BAFF dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour BAFF anticorps (ABIN634541)

Antigène: BAFF (TNFSF13B) (Tumor Necrosis Factor (Ligand) Superfamily, Member 13b (TNFSF13B))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BAFF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-BAFF anticorps

Purification: Affinity purified

Immunogène: TNFSF13 B antibody was raised using a synthetic peptide corresponding to a region with amino acids ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TNFSF13B Blocking Peptide, (ABIN936749), is also available for use as a blocking control in assays to test for specificity of this TNFSF13B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNFSF10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BAFF

Antigène: BAFF (TNFSF13B) (Tumor Necrosis Factor (Ligand) Superfamily, Member 13b (TNFSF13B))

Autre désignation: TNFSF13B

Sujet: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Signalisation NF-kappaB, Production of Molecular Mediator of Immune Response