ADCY10 anticorps (N-Term)

N° du produit ABIN634544

L’anticorps Lapin Polyclonal anti-ADCY10 a été validé pour WB. Il convient pour détecter ADCY10 dans des échantillons de Humain, Rat et Souris.

Aperçu rapide pour ADCY10 anticorps (N-Term) (ABIN634544)

Antigène: ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ADCY10 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ADCY10 anticorps

Épitope: N-Term

Specificité: SAC antibody was raised against the N terminal Of Sac

Purification: Affinity purified

Immunogène: SAC antibody was raised using the N terminal Of Sac corresponding to a region with amino acids VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAC Blocking Peptide, (ABIN5615992), is also available for use as a blocking control in assays to test for specificity of this SAC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ADCY10

Antigène: ADCY10 (Adenylate Cyclase 10 (Soluble) (ADCY10))

Autre désignation: SAC

Sujet: SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.

Poids moléculaire: 187 kDa (MW of target protein)

Pathways: cAMP Metabolic Process