TLR5 anticorps (N-Term)

N° du produit ABIN634552

Cet anticorps Lapin Polyclonal détecte spécifiquement TLR5 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour TLR5 anticorps (N-Term) (ABIN634552)

Antigène: TLR5 (Toll-Like Receptor 5 (TLR5))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TLR5 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TLR5 anticorps

Épitope: N-Term

Specificité: TLR5 antibody was raised against the N terminal of TLR5

Purification: Affinity purified

Immunogène: TLR5 antibody was raised using the N terminal of TLR5 corresponding to a region with amino acids QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TLR5 Blocking Peptide, (ABIN5616638), is also available for use as a blocking control in assays to test for specificity of this TLR5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TLR5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TLR5

Antigène: TLR5 (Toll-Like Receptor 5 (TLR5))

Autre désignation: TLR5

Sujet: TLR5 participates in the innate immune response to microbial agents. It mediates detection of bacterial flagellins. TLR5 acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.

Poids moléculaire: 98 kDa (MW of target protein)

Pathways: Signalisation TLR, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Toll-Like Receptors Cascades