MAPT anticorps (Middle Region)
-
- Antigène Voir toutes MAPT Anticorps
- MAPT (Microtubule-Associated Protein tau (MAPT))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MAPT est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- MAPT antibody was raised against the middle region of MAPT
- Purification
- Affinity purified
- Immunogène
- MAPT antibody was raised using the middle region of MAPT corresponding to a region with amino acids NAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLAD
- Top Product
- Discover our top product MAPT Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MAPT Blocking Peptide, catalog no. 33R-6638, is also available for use as a blocking control in assays to test for specificity of this MAPT antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPT antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MAPT (Microtubule-Associated Protein tau (MAPT))
- Autre désignation
- MAPT (MAPT Produits)
- Synonymes
- anticorps DDPAC, anticorps FTDP-17, anticorps MAPTL, anticorps MSTD, anticorps MTBT1, anticorps MTBT2, anticorps PPND, anticorps TAU, anticorps AI413597, anticorps AW045860, anticorps Mtapt, anticorps Tau, anticorps RNPTAU, anticorps pTau, anticorps tau, anticorps xtp, anticorps MAPT, anticorps PHF-tau, anticorps slc6a6, anticorps taut, anticorps wu:fc26e12, anticorps microtubule associated protein tau, anticorps microtubule-associated protein tau, anticorps microtubule associated protein tau S homeolog, anticorps Microtubule-associated protein tau, anticorps solute carrier family 6 (neurotransmitter transporter), member 6b, anticorps MAPT, anticorps Mapt, anticorps mapt.S, anticorps LOC5580230, anticorps CpipJ_CPIJ013260, anticorps tau, anticorps slc6a6b
- Sujet
- MAPT is differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. The mutations in the gene have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.
- Poids moléculaire
- 40 kDa (MW of target protein)
- Pathways
- Signalisation MAPK, Dynamique des Microtubules, M Phase, Regulation of Cell Size
-