MAPT anticorps (Middle Region)

N° du produit ABIN634593

Cet anticorps anti-MAPT Polyclonal Lapin (ABIN634593) détecte spécifiquement MAPT dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour MAPT anticorps (Middle Region) (ABIN634593)

Antigène: MAPT (Microtubule-Associated Protein tau (MAPT))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MAPT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MAPT anticorps

Épitope: Middle Region

Specificité: MAPT antibody was raised against the middle region of MAPT

Purification: Affinity purified

Immunogène: MAPT antibody was raised using the middle region of MAPT corresponding to a region with amino acids NAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSSTGSIDMVDSPQLATLAD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MAPT Blocking Peptide, (ABIN5614670), is also available for use as a blocking control in assays to test for specificity of this MAPT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAPT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MAPT

Antigène: MAPT (Microtubule-Associated Protein tau (MAPT))

Autre désignation: MAPT

Sujet: MAPT is differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. The mutations in the gene have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Signalisation MAPK, Dynamique des Microtubules, M Phase, Regulation of Cell Size