PPP1R13B anticorps

N° du produit ABIN634596

Cet anticorps anti-PPP1R13B Polyclonal Lapin (ABIN634596) détecte spécifiquement PPP1R13B dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PPP1R13B anticorps (ABIN634596)

Antigène: PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPP1R13B est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PPP1R13B anticorps

Purification: Affinity purified

Immunogène: PPP1 R11 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFDLVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPP1R13B Blocking Peptide, (ABIN937786), is also available for use as a blocking control in assays to test for specificity of this PPP1R13B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPP1R13B

Antigène: PPP1R13B (Protein Phosphatase 1, Regulatory Subunit 13B (PPP1R13B))

Autre désignation: PPP1R13B

Sujet: PPP1R13B is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. The protein contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. ASPP proteins are required for the induction of apoptosis by p53-family proteins. They promote DNA binding and transactivation of p53-family proteins on the promoters of proapoptotic genes. Expression of this gene is regulated by the E2F transcription factor.

Poids moléculaire: 119 kDa (MW of target protein)

Pathways: Signalisation p53