MFAP4 anticorps (N-Term)

N° du produit ABIN634642

Détail du produit anti-MFAP4 anticorps

Antigène: MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))

Épitope: N-Term

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MFAP4 est non-conjugé

Application: Western Blotting (WB)

Specificité: MFAP4 antibody was raised against the N terminal of MFAP4

Purification: Affinity purified

Immunogène: MFAP4 antibody was raised using the N terminal of MFAP4 corresponding to a region with amino acids TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MFAP4 Blocking Peptide, catalog no. 33R-9037, is also available for use as a blocking control in assays to test for specificity of this MFAP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MFAP4

Antigène: MFAP4 (Microfibrillar-Associated Protein 4 (MFAP4))

Autre désignation: MFAP4 (MFAP4 Produits)

Synonymes: anticorps 1110007F23Rik, anticorps Magp-36, anticorps zgc:77076, anticorps microfibril-associated glycoprotein 4, anticorps microfibrillar-associated protein 4, anticorps microfibril associated protein 4 S homeolog, anticorps microfibril associated protein 4, anticorps CpipJ_CPIJ000434, anticorps CpipJ_CPIJ006120, anticorps CpipJ_CPIJ010089, anticorps CpipJ_CPIJ018551, anticorps CpipJ_CPIJ020296, anticorps mfap4, anticorps mfap4.S, anticorps MFAP4, anticorps Mfap4

Sujet: MFAP4 is a protein with similarity to a bovine microfibril-associated protein. The protein has binding specificities for both collagen and carbohydrate. It is thought to be an extracellular matrix protein which is involved in cell adhesion or intercellular interactions. The gene encoding MFAP4 is located within the Smith-Magenis syndrome region.

Poids moléculaire: 29 kDa (MW of target protein)