SIPA1 anticorps (Middle Region)

N° du produit ABIN634653

Cet anticorps anti-SIPA1 Polyclonal Lapin (ABIN634653) détecte spécifiquement SIPA1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour SIPA1 anticorps (Middle Region) (ABIN634653)

Antigène: SIPA1 (Signal-Induced Proliferation-Associated 1 (SIPA1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SIPA1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SIPA1 anticorps

Épitope: Middle Region

Specificité: SIPA1 antibody was raised against the middle region of SIPA1

Purification: Affinity purified

Immunogène: SIPA1 antibody was raised using the middle region of SIPA1 corresponding to a region with amino acids TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SIPA1 Blocking Peptide, (ABIN5616155), is also available for use as a blocking control in assays to test for specificity of this SIPA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIPA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SIPA1

Antigène: SIPA1 (Signal-Induced Proliferation-Associated 1 (SIPA1))

Autre désignation: SIPA1

Sujet: The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases.

Poids moléculaire: 112 kDa (MW of target protein)

Pathways: Response to Water Deprivation