SIPA1 anticorps (Middle Region)
-
- Antigène Voir toutes SIPA1 Anticorps
- SIPA1 (Signal-Induced Proliferation-Associated 1 (SIPA1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SIPA1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SIPA1 antibody was raised against the middle region of SIPA1
- Purification
- Affinity purified
- Immunogène
- SIPA1 antibody was raised using the middle region of SIPA1 corresponding to a region with amino acids TAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRASFLPRTLSLRNS
- Top Product
- Discover our top product SIPA1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SIPA1 Blocking Peptide, catalog no. 33R-8976, is also available for use as a blocking control in assays to test for specificity of this SIPA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIPA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SIPA1 (Signal-Induced Proliferation-Associated 1 (SIPA1))
- Autre désignation
- SIPA1 (SIPA1 Produits)
- Synonymes
- anticorps Spa1, anticorps SPA1, anticorps signal-induced proliferation-associated 1, anticorps Signal peptidase I (leader peptidase I), anticorps signal-induced proliferation associated gene 1, anticorps SIPA1, anticorps sipA1, anticorps Sipa1
- Sujet
- The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases.
- Poids moléculaire
- 112 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation
-