Fibronectin 1 anticorps (N-Term)

N° du produit ABIN634655

L’anticorps anti-Fibronectin 1 Polyclonal Lapin est utilisé pour la détection de Fibronectin 1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour Fibronectin 1 anticorps (N-Term) (ABIN634655)

Antigène: Fibronectin 1 (FN1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Fibronectin 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Fibronectin 1 anticorps

Épitope: N-Term

Specificité: Fibronectin 1 antibody was raised against the N terminal of FN1

Purification: Affinity purified

Immunogène: Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Fibronectin 1 Blocking Peptide, (ABIN938829), is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Fibronectin 1

Antigène: Fibronectin 1 (FN1)

Autre désignation: Fibronectin 1

Sujet: FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis and wound healing.

Poids moléculaire: 71 kDa (MW of target protein)

Pathways: Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy