Fibronectin 1 anticorps (N-Term)
-
- Antigène Voir toutes Fibronectin 1 (FN1) Anticorps
- Fibronectin 1 (FN1)
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Fibronectin 1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Fibronectin 1 antibody was raised against the N terminal of FN1
- Purification
- Affinity purified
- Immunogène
- Fibronectin 1 antibody was raised using the N terminal of FN1 corresponding to a region with amino acids GNALVCTCYGGSRGFNCESKPEAEETCFDKYTGNTYRVGDTYERPKDSMI
- Top Product
- Discover our top product FN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Fibronectin 1 Blocking Peptide, catalog no. 33R-3443, is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Fibronectin 1 (FN1)
- Autre désignation
- Fibronectin 1 (FN1 Produits)
- Synonymes
- anticorps FN1, anticorps FN, anticorps cig, anticorps fibronectin, anticorps finc, anticorps lets, anticorps msf, anticorps Fn, anticorps fn2, anticorps fb80d10, anticorps wu:fb80d10, anticorps CIG, anticorps ED-B, anticorps FINC, anticorps FNZ, anticorps GFND, anticorps GFND2, anticorps LETS, anticorps MSF, anticorps E330027I09, anticorps Fn-1, anticorps FIBNEC, anticorps fn-1, anticorps fibronectin 1, anticorps fibronectin 1a, anticorps fibronectin 1 S homeolog, anticorps FN1, anticorps fn1, anticorps fn1a, anticorps Fn1, anticorps fn1.S
- Sujet
- FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis and wound healing.
- Poids moléculaire
- 71 kDa (MW of target protein)
- Pathways
- Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy
-